Ll-37, the Neutrophil Granule–And Epithelial Cell–Derived Cathelicidin, Utilizes Formyl Peptide Receptor–Like 1 (Fprl1) as a Receptor to Chemoattract Human Peripheral Blood Neutrophils, Monocytes,…

By De Yang, Qian Chen, A. Schmidt, G. Anderson, Ji Ming Wang, J. Wooters, Joost J. Oppenheim, O. Chertov. Journal of Experimental Medicine, 2000

1,318 citations recorded by the source corpus.

We have previously shown that antimicrobial peptides like defensins have the capacity to mobilize leukocytes in host defense. LL-37 is the cleaved antimicrobial 37-residue, COOH-terminal peptide of hCAP18 (human cationic antimicrobial protein with a molecular size of 18 kD), the only identified member in humans of a family of proteins called cathelicidins. LL-37/hCAP18 is produced by neutrophils and various epithelial cells. Here we report that LL-37 is chemotactic for, and can induce Ca2+ mobilization in, human monocytes and formyl peptide receptor–like 1 (FPRL1)-transfected human embryonic kidney 293 cells. LL-37–induced Ca2+ mobilization in monocytes can also be cross-desensitized by an FPRL1-specific agonist. Furthermore, LL-37 is also chemotactic for human neutrophils and T lymphocytes that are known to express FPRL1. Our results suggest that, in addition to its microbicidal activity, LL-37 may contribute to innate and adaptive immunity by recruiting neutrophils, monocytes, and T cells to sites of microbial invasion by interacting with FPRL1.

Subfields: Cellular and Molecular Neuroscience, Immunology, Microbiology

View Paper: https://www.semanticscholar.org/paper/71f39a6ded5ea43aaf74dfe82772f7533a2b64e1

How researchers see this paper

The researchers whose trusted networks rank it highest, strongest advocate first. Every researcher gets a different order.

In Cellular and Molecular Neuroscience

Robert E. W. Hancock

In Immunology

In Microbiology

Citations in the corpus

Cationic host defense (antimicrobial) peptides. (2006, background): “LL-37 directly mediates chemotaxis of human peripheral blood neutrophils, monocytes and T cells through formyl peptide receptor-like 1 [73]), other biological functions are not associated with known receptors.”
Multifunctional cationic host defence peptides and their clinical applications (2011, background): “For example, LL-37 attracts neutrophils, monocytes, T cells, and mast cells, using the G protein-coupled formylpeptide receptor-like 1 (FPRL1) [117].”
Mechanisms and consequences of bacterial resistance to antimicrobial peptides. (2016, background): “The human cathelicidin LL-37 modulates the innate immune response by acting as a chemoattractant for neutrophils, monocytes, and mast cells (Niyonsaba et al., 2002b; Yang et al., 2000) and human -defensins chemoattract leukocytes (Garcia et al., 2001a; Niyonsaba et al., 2002a; Territo et al., 1989).”
Specific Recruitment of Antigen-presenting Cells by Chemerin, a Novel Processed Ligand from Human Inflammatory Fluids (2003, background): “Both the COOH-terminal peptide and the structured NH2-terminal (cystatin-like) domain have been shown to display chemotactic properties for leukocytes, properties which involve G protein–coupled receptors (26, 27).”
International Union of Basic and Clinical Pharmacology. LXXIII. Nomenclature for the Formyl Peptide Receptor (FPR) Family (2009, background): “LL-37 ([LL-37, 37 aa]), an enzymatic cleavage fragment of the neutrophil granule protein cathelicidin (Yang et al., 2000), and its mouse homolog CRAMP (GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ) (Kurosaka et al.”